★★★★★
IGF-1 LR3 1mg arrived with clear documentation, intact packaging and a batch-specific COA that made internal receipt checks straightforward.
IGF-1 LR3 1mg
VIP 10mg
SKU: VIP 10mg
59.99 €
For research use only. Not for human or animal consumption. By purchasing, you accept all associated risks.
VIP 10mg
VIP, short for Vasoactive Intestinal Peptide, is a naturally occurring 28-amino-acid neuropeptide that has been extensively studied in molecular biology, physiology and receptor pharmacology. Synthetic VIP is used experimentally to investigate the signalling mechanisms associated with this naturally occurring peptide.
First isolated in the early 1970s, VIP was initially identified in intestinal tissue but was subsequently found to have a much broader distribution throughout the nervous system and other tissues. These discoveries led to extensive scientific interest in its role as a signalling molecule.
VIP exerts its biological activity primarily through VPAC1 and VPAC2 receptors, members of the G-protein-coupled receptor family. Researchers have studied these receptor interactions to understand downstream signalling mechanisms, including pathways involving cyclic adenosine monophosphate (cAMP).
Published research involving VIP spans a broad range of biological systems. Experimental studies have investigated its involvement in neuropeptide signalling, vascular biology, smooth-muscle regulation, immune and inflammatory signalling, gastrointestinal physiology and cellular communication.
VIP is also of interest in neuroscience and molecular research because of its function as a neuropeptide and neurotransmitter/modulator. Laboratory models have been used to investigate how VIP-mediated signalling influences communication between cells and interacts with other regulatory pathways.
These characteristics have established VIP as an important research peptide for investigating receptor pharmacology, cellular signalling and the molecular mechanisms associated with neuropeptide activity.
This preparation contains 10 mg of lyophilised VIP supplied exclusively as a laboratory research material.
LABORATORY RESEARCH CHEMICAL ONLY
Strictly for in vitro laboratory research by qualified professionals.
NOT FOR HUMAN OR ANIMAL USE.
NOT FOR MEDICAL, THERAPEUTIC, DIAGNOSTIC OR CONSUMPTION PURPOSES.
No dosing, administration, reconstitution or clinical-use guidance is provided.
VIP 10mg |
|
| CAS Number | 140077-57-4 |
| Molar Mass | 3325.8 g/mol |
| Molecular Formula | C₁₄₇H₂₃₇N₄₃O₄₃S |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ |
Important Reminder:
Before reconstitution, ensure both the peptide and bacteriostatic mixing water are at room temperature to support proper dissolution and avoid destabilising the compound.
Bacteriostatic mixing water sold separately.
Disclaimer
All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise.
The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Terms and Conditions and acknowledge that you will abide by these terms.
TEST RESULTS
What our customers say
★★★★★
AOD 9604 5mg was dispatched quickly and the labeling was precise. The published test data matched what our team expected from a research supplier.
AOD 9604 5mg
★★★★★
AOD 9604 10mg was easy to verify against the listed batch information. Clean presentation, responsive support and smooth EU delivery.
AOD 9604 10mg and Mixing Water 3ml (2% Acetic Acid) A sterile reconstitution solution containing 2% acetic acid
★★★★★
Thymosin Alpha 1 10mg came with the level of traceability we need. The online certificate and packaging consistency were both very good.
Thymosin Alpha 1 10mg
★★★★★
Thymosin Alpha 1 Nasal Spray 10mg was packed securely and delivered on time. Useful product page details and a professional overall process.
Thymosin Alpha 1 Nasal Spray 10mg
★★★★★
GLOW 70mg pen order was handled efficiently and the quality paperwork was easy to review before purchase.
★★★★★
Selank Nasal Spray 10mg arrived with clear instructions and careful packing. The experience felt well organized from checkout to delivery.
Selank Nasal Spray 10mg
★★★★★
Semax Nasal Spray 10mg was exactly as described. Strong communication, fast processing and transparent product documentation.
Semax Nasal Spray 10mg
★★★★★
Our Berlin team ordered IGF-1 LR3 1mg and the process was excellent from checkout to delivery. The batch data was easy to review and the packaging arrived in very professional condition.
IGF-1 LR3 1mg
SKU: VIP 10mg
VIP 10mg
VIP 10mg
VIP, short for Vasoactive Intestinal Peptide, is a naturally occurring 28-amino-acid neuropeptide that has been extensively studied in molecular biology, physiology and receptor pharmacology. Synthetic VIP is used experimentally to investigate the signalling mechanisms associated with this naturally occurring peptide.
First isolated in the early 1970s, VIP was initially identified in intestinal tissue but was subsequently found to have a much broader distribution throughout the nervous system and other tissues. These discoveries led to extensive scientific interest in its role as a signalling molecule.
VIP exerts its biological activity primarily through VPAC1 and VPAC2 receptors, members of the G-protein-coupled receptor family. Researchers have studied these receptor interactions to understand downstream signalling mechanisms, including pathways involving cyclic adenosine monophosphate (cAMP).
Published research involving VIP spans a broad range of biological systems. Experimental studies have investigated its involvement in neuropeptide signalling, vascular biology, smooth-muscle regulation, immune and inflammatory signalling, gastrointestinal physiology and cellular communication.
VIP is also of interest in neuroscience and molecular research because of its function as a neuropeptide and neurotransmitter/modulator. Laboratory models have been used to investigate how VIP-mediated signalling influences communication between cells and interacts with other regulatory pathways.
These characteristics have established VIP as an important research peptide for investigating receptor pharmacology, cellular signalling and the molecular mechanisms associated with neuropeptide activity.
This preparation contains 10 mg of lyophilised VIP supplied exclusively as a laboratory research material.
LABORATORY RESEARCH CHEMICAL ONLY
Strictly for in vitro laboratory research by qualified professionals.
NOT FOR HUMAN OR ANIMAL USE.
NOT FOR MEDICAL, THERAPEUTIC, DIAGNOSTIC OR CONSUMPTION PURPOSES.
No dosing, administration, reconstitution or clinical-use guidance is provided.
VIP 10mg |
|
| CAS Number | 140077-57-4 |
| Molar Mass | 3325.8 g/mol |
| Molecular Formula | C₁₄₇H₂₃₇N₄₃O₄₃S |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ |
Important Reminder:
Before reconstitution, ensure both the peptide and bacteriostatic mixing water are at room temperature to support proper dissolution and avoid destabilising the compound.
Bacteriostatic mixing water sold separately.
Disclaimer
All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise.
The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Terms and Conditions and acknowledge that you will abide by these terms.
59.99 €